PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G384300.1.p
Common NameSb02g040050, SORBIDRAFT_02g040050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 650aa    MW: 71134.7 Da    PI: 4.3683
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G384300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.85.2e-133579348
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +W++eEd  l   ++++G+++W+ Ia+ +   +t+ qc+ rw++yl
  Sobic.002G384300.1.p 35 SWSAEEDGVLRAQIALHGTDNWTIIAAQFK-DKTARQCRRRWYNYL 79
                          6****************************9.**************7 PP

2Myb_DNA-binding408.9e-1385128146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           +g W+ eEd ll +a k lG++ W+ Ia+ +  gRt++ +k+r+ +
  Sobic.002G384300.1.p  85 KGGWSREEDMLLCEAQKVLGNK-WTEIAKVVS-GRTDNAVKNRFST 128
                           688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.1372883IPR017930Myb domain
SuperFamilySSF466895.24E-2632126IPR009057Homeodomain-like
SMARTSM007173.1E-113281IPR001005SANT/Myb domain
CDDcd001678.62E-123579No hitNo description
Gene3DG3DSA:1.10.10.601.3E-183686IPR009057Homeodomain-like
PfamPF139211.5E-143696No hitNo description
SMARTSM007173.9E-1384132IPR001005SANT/Myb domain
PROSITE profilePS5129416.65284134IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-1987133IPR009057Homeodomain-like
CDDcd001672.16E-988129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 650 aa     Download sequence    Send to blast
MATGPDLSSS SSGAAAAAAV PDAAAAARKD RHIVSWSAEE DGVLRAQIAL HGTDNWTIIA  60
AQFKDKTARQ CRRRWYNYLN SECKKGGWSR EEDMLLCEAQ KVLGNKWTEI AKVVSGRTDN  120
AVKNRFSTLC KRRAKDEELY QENGVPCSNT NAKRVLTETG CLTPGGAASL LHIKQMRSSS  180
SDLKENLVPN MRLFEQEKST QDARQPLATI SSNNQDNVNT VKSQNCVKRE GNFLNKDDPK  240
VATLLQQADL LCSLATKIKS DNTSQSMDEA WQQLQDHLMK KEHNEVPENS GSEIGSLLEE  300
LDDLIVDPYE SKDEDGQKLS EHIGQTDVDN DHCNGSSQTS IEVTSNMVPE EMMKDCPVDN  360
CKEDNSLCRN VLSGSTEPCP GAIPACGNSS KDQVAEDSNS MLQRVESTSP VITDIDDLII  420
DPYESEEEDE ENSGEQNRQI NVHDEQCFGS SQTVMEVISD MAPDEVMKTC PAGNCEEHNS  480
ICQNVLSGSM EPCPGAEILA SEKLSELDED SRLQCMEFAS PVLTNFESKD CGETPAPQNL  540
NEIAEDSRLQ CIEFTSPAHT VLRDKAGVEN FASPSFAVVA KDSKPPSSEF TSPAHTVATF  600
QPYADDMPTP KFTASERNFL LSVIELTSPG SRPETSQHPS CKRALLNSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-293613310107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.290.0leaf| panicle| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0190050.0BT019005.1 Zea mays clone Contig495.F mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002463221.10.0hypothetical protein SORBIDRAFT_02g040050
TrEMBLC5X2M30.0C5X2M3_SORBI; Putative uncharacterized protein Sb02g040050
STRINGSb02g040050.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89033847
Representative plantOGRP54161421
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.29e-88MYB family protein